Lineage for d1rw6a_ (1rw6 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770353Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 770396Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (1 family) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold ((46965))
  5. 770397Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (1 protein)
  6. 770398Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species)
  7. 770399Species Human (Homo sapiens) [TaxId:9606] [109846] (2 PDB entries)
    Uniprot P05067 374-569 # structures are known for other fragments: 28-123 ((56494)); 124-189 ((89814)); 287-344 ((57371)); 681-/-711 ((58608))
  8. 770400Domain d1rw6a_: 1rw6 A: [105113]
    contains extra N-terminal alpha-hairpin

Details for d1rw6a_

PDB Entry: 1rw6 (more details), 2.8 Å

PDB Description: human APP core domain
PDB Compounds: (A:) amyloid beta a4 protein

SCOP Domain Sequences for d1rw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw6a_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]}
avdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviq
hfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnm
lkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpa
vaeeiqdevdel

SCOP Domain Coordinates for d1rw6a_:

Click to download the PDB-style file with coordinates for d1rw6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rw6a_: