Class a: All alpha proteins [46456] (284 folds) |
Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (1 family) the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold ((46965)) |
Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (1 protein) |
Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109846] (2 PDB entries) Uniprot P05067 374-569 # structures are known for other fragments: 28-123 ((56494)); 124-189 ((89814)); 287-344 ((57371)); 681-/-711 ((58608)) |
Domain d1rw6a_: 1rw6 A: [105113] contains extra N-terminal alpha-hairpin |
PDB Entry: 1rw6 (more details), 2.8 Å
SCOP Domain Sequences for d1rw6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rw6a_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]} avdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviq hfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnm lkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpa vaeeiqdevdel
Timeline for d1rw6a_: