PDB entry 1rw6

View 1rw6 on RCSB PDB site
Description: human APP core domain
Class: cell adhesion
Keywords: coiled-coil, dimer
Deposited on 2003-12-16, released 2004-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.287
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: HOMO SAPIENS
    Gene: APP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rw6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rw6A (A:)
    gshmpttaastpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqa
    knlpkadkkaviqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyital
    qavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyer
    mnqslsllynvpavaeeiqdevdellqkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rw6A (A:)
    avdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkkaviq
    hfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhvfnm
    lkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllynvpa
    vaeeiqdevdel