Lineage for d1rtga_ (1rtg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553728Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 1553729Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 1553730Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. 1553740Protein Gelatinase A (MMP-2), C-terminal domain [50927] (1 species)
  7. 1553741Species Human (Homo sapiens) [TaxId:9606] [50928] (4 PDB entries)
  8. 1553743Domain d1rtga_: 1rtg A: [27537]
    complexed with ca, cl

Details for d1rtga_

PDB Entry: 1rtg (more details), 2.6 Å

PDB Description: c-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
PDB Compounds: (A:) human gelatinase a

SCOPe Domain Sequences for d1rtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtga_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tptlgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelp
ekidavyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwskn
kktyifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayy
lklenqslksvkfgsiksdwlgc

SCOPe Domain Coordinates for d1rtga_:

Click to download the PDB-style file with coordinates for d1rtga_.
(The format of our PDB-style files is described here.)

Timeline for d1rtga_: