Lineage for d1rrka2 (1rrk A:243-452)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) 
Protein Complement factor B domain [102541] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102542] (5 PDB entries)
Uniprot P00751 268-764
Domain d1rrka2: 1rrk A:243-452 [111925]
Other proteins in same PDB: d1rrka1
complexed with co, iod, na
Details for d1rrka2
PDB Entry: 1rrk (more details), 2 Å
PDB Description: crystal structure analysis of the bb segment of factor b
PDB Compounds: (A:) complement factor bSCOPe Domain Sequences for d1rrka2:
Sequence, based on SEQRES records: (download)
>d1rrka2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvckvkdmecledvfyqmidesqslsl
Sequence, based on observed residues (ATOM records): (download)
>d1rrka2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpgwnrtrhviilmtdglhn
mggdpitvideirdllyigkdrnpredyldvyvfgvgplvnqvninalaskkdneqhvck
vkdmecledvfyqmidesqslsl
SCOPe Domain Coordinates for d1rrka2:
Click to download the PDB-style file with coordinates for d1rrka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rrka2:
- d1rrka2 first appeared in SCOP 1.71
- d1rrka2 appears in SCOPe 2.05
- d1rrka2 appears in SCOPe 2.07
- d1rrka2 appears in the current release, SCOPe 2.08
View in 3D
