Lineage for d1rlua2 (1rlu A:206-312)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
Uniprot O08378
Domain d1rlua2: 1rlu A:206-312 [104985]
Other proteins in same PDB: d1rlua1, d1rlub1
complexed with gol, gsp
Details for d1rlua2
PDB Entry: 1rlu (more details), 2.08 Å
PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d1rlua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlua2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
SCOPe Domain Coordinates for d1rlua2:
Click to download the PDB-style file with coordinates for d1rlua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rlua2:
- d1rlua2 first appeared in SCOP 1.69
- d1rlua2 appears in SCOPe 2.03
- d1rlua2 appears in SCOPe 2.05
- d1rlua2 appears in the current release, SCOPe 2.08
View in 3D
