Lineage for d1rkwa1 (1rkw A:2-72)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477968Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1478006Protein Multidrug binding protein QacR [68964] (1 species)
  7. 1478007Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 1478018Domain d1rkwa1: 1rkw A:2-72 [104967]
    Other proteins in same PDB: d1rkwa2, d1rkwb2, d1rkwd2, d1rkwe2
    complexed with pnt, so4

Details for d1rkwa1

PDB Entry: 1rkw (more details), 2.62 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
PDB Compounds: (A:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1rkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkwa1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1rkwa1:

Click to download the PDB-style file with coordinates for d1rkwa1.
(The format of our PDB-style files is described here.)

Timeline for d1rkwa1: