Lineage for d1ri9a_ (1ri9 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796288Protein Fyn-binding protein (T-cell adapter protein adap) [101681] (1 species)
  7. 796289Species Human (Homo sapiens) [TaxId:9606] [101682] (1 PDB entry)
  8. 796290Domain d1ri9a_: 1ri9 A: [97506]
    helically extended ant the N-terminus

Details for d1ri9a_

PDB Entry: 1ri9 (more details)

PDB Description: structure of a helically extended sh3 domain of the t cell adapter protein adap
PDB Compounds: (A:) FYN-binding protein

SCOP Domain Sequences for d1ri9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]}
ekeekdfrkkfkydgeirvlystkvttsitskkwgtrdlqvkpgesleviqttddtkvlc
rneegkygyvlrsylad

SCOP Domain Coordinates for d1ri9a_:

Click to download the PDB-style file with coordinates for d1ri9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ri9a_: