Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein Fyn-binding protein (T-cell adapter protein adap) [101681] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101682] (1 PDB entry) |
Domain d1ri9a_: 1ri9 A: [97506] helically extended ant the N-terminus |
PDB Entry: 1ri9 (more details)
SCOP Domain Sequences for d1ri9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} ekeekdfrkkfkydgeirvlystkvttsitskkwgtrdlqvkpgesleviqttddtkvlc rneegkygyvlrsylad
Timeline for d1ri9a_: