Lineage for d1ri7a2 (1ri7 A:85-170)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
octamer: tetramer of dimers
automatically mapped to Pfam PF01037
Protein Putative transcriptional regulator PH1519 [102968] (1 species)
archaeal feast/famine regulatory proteinSpecies Pyrococcus horikoshii [TaxId:53953] [102969] (4 PDB entries)
identical sequence to Pyrococcus sp. ot3 protein
Domain d1ri7a2: 1ri7 A:85-170 [97505]
Other proteins in same PDB: d1ri7a1
Details for d1ri7a2
PDB Entry: 1ri7 (more details), 2.7 Å
PDB Description: crystal structure of a protein in the LRP/ASNC family from the hyperthermophilic archaeon Pyrococcus sp. OT3
PDB Compounds: (A:) Putative transcriptional regulatorSCOPe Domain Sequences for d1ri7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ri7a2 d.58.4.2 (A:85-170) Putative transcriptional regulator PH1519 {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi
SCOPe Domain Coordinates for d1ri7a2:
Click to download the PDB-style file with coordinates for d1ri7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ri7a2:
- d1ri7a2 first appeared in SCOP 1.67
- d1ri7a2 appears in SCOPe 2.06
- d1ri7a2 appears in the current release, SCOPe 2.08
View in 3D
