Lineage for d1rcfa_ (1rcf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838448Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1838449Protein Flavodoxin [52220] (10 species)
  7. 1838450Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 1838453Domain d1rcfa_: 1rcf A: [31170]
    complexed with fmn, so4

Details for d1rcfa_

PDB Entry: 1rcf (more details), 1.4 Å

PDB Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1rcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcfa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1rcfa_:

Click to download the PDB-style file with coordinates for d1rcfa_.
(The format of our PDB-style files is described here.)

Timeline for d1rcfa_: