![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
![]() | Superfamily g.53.1: TAZ domain [57933] (1 family) ![]() automatically mapped to Pfam PF02135 |
![]() | Family g.53.1.1: TAZ domain [57934] (2 proteins) |
![]() | Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57936] (7 PDB entries) |
![]() | Domain d1r8ub_: 1r8u B: [97250] Other proteins in same PDB: d1r8ua_ CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A) complexed with zn |
PDB Entry: 1r8u (more details)
SCOPe Domain Sequences for d1r8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8ub_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]} atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa gkacqvahcassrqiishwknctrhdcpvclplknasdkr
Timeline for d1r8ub_: