Lineage for d1r8ea1 (1r8e A:3-120)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261200Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1261201Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1261232Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 1261238Protein Transcription activator BmrR [46963] (1 species)
    followed by long alpha-helical linker
  7. 1261239Species Bacillus subtilis [TaxId:1423] [46964] (7 PDB entries)
    Uniprot P39075
  8. 1261240Domain d1r8ea1: 1r8e A:3-120 [104843]
    Other proteins in same PDB: d1r8ea2
    protein/DNA complex; complexed with gol, imd, p4p

Details for d1r8ea1

PDB Entry: 1r8e (more details), 2.4 Å

PDB Description: Crystal Structure of BmrR Bound to DNA at 2.4A Resolution
PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1r8ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

SCOPe Domain Coordinates for d1r8ea1:

Click to download the PDB-style file with coordinates for d1r8ea1.
(The format of our PDB-style files is described here.)

Timeline for d1r8ea1: