SCOPe 2.08: Domain d1r8ea1: 1r8e A:3-120

Lineage for d1r8ea1 (1r8e A:3-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein Transcription activator BmrR [46963] (1 species)
   followed by long alpha-helical linker

7. Species Bacillus subtilis [TaxId:1423] [46964] (4 PDB entries)
   Uniprot P39075

8. Domain d1r8ea1: 1r8e A:3-120 [104843]
   Other proteins in same PDB: d1r8ea2
   protein/DNA complex; complexed with gol, imd, p4p

Details for d1r8ea1

PDB Entry: 1r8e, 2.4 Å

PDB Description: Crystal Structure of BmrR Bound to DNA at 2.4A Resolution

PDB Compounds: (A:) multidrug-efflux transporter regulator

SCOPe Domain Sequences for d1r8ea1:

Sequence; same for both SEQRES and ATOM records:

>d1r8ea1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d1r8ea1:

• d1r8ea1 first appeared in SCOP 1.69
  
• d1r8ea1 appears in SCOPe 2.07