Lineage for d1r3ea2 (1r3e A:10-237)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687861Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1687862Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1687877Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 1687878Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 1687892Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)
  8. 1687893Domain d1r3ea2: 1r3e A:10-237 [96908]
    Other proteins in same PDB: d1r3ea1
    protein/RNA complex

Details for d1r3ea2

PDB Entry: 1r3e (more details), 2.1 Å

PDB Description: crystal structure of trna pseudouridine synthase trub and its rna complex: rna-protein recognition through a combination of rigid docking and induced fit
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1r3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ea2 d.265.1.2 (A:10-237) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

SCOPe Domain Coordinates for d1r3ea2:

Click to download the PDB-style file with coordinates for d1r3ea2.
(The format of our PDB-style files is described here.)

Timeline for d1r3ea2:

1687893
d1r3ea2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1r3ea1