Lineage for d1r31a2 (1r31 A:3-110,A:221-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004881Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 3004882Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 3004883Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 3004884Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 3004922Species Pseudomonas mevalonii [TaxId:32044] [56546] (11 PDB entries)
    Uniprot P13702 4-377
  8. 3004931Domain d1r31a2: 1r31 A:3-110,A:221-378 [96898]
    Other proteins in same PDB: d1r31a1, d1r31b1
    complexed with coa, mev, so4

Details for d1r31a2

PDB Entry: 1r31 (more details), 2.1 Å

PDB Description: HMG-CoA reductase from Pseudomonas mevalonii complexed with HMG-CoA
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d1r31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
ldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpy
avasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritp
qqletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveaga
hayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaq
alaeiavavglaqnlgamralategiq

SCOPe Domain Coordinates for d1r31a2:

Click to download the PDB-style file with coordinates for d1r31a2.
(The format of our PDB-style files is described here.)

Timeline for d1r31a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r31a1