Lineage for d1r2ya1 (1r2y A:135-228)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735377Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 2735378Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 2735379Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)
  8. 2735393Domain d1r2ya1: 1r2y A:135-228 [96889]
    Other proteins in same PDB: d1r2ya2, d1r2ya3
    bound to 8-Oxoguanine (OxoG) containing DNA
    protein/DNA complex; complexed with zn

Details for d1r2ya1

PDB Entry: 1r2y (more details), 2.34 Å

PDB Description: MutM (Fpg) bound to 8-oxoguanine (oxoG) containing DNA
PDB Compounds: (A:) MutM

SCOPe Domain Sequences for d1r2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ya1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

SCOPe Domain Coordinates for d1r2ya1:

Click to download the PDB-style file with coordinates for d1r2ya1.
(The format of our PDB-style files is described here.)

Timeline for d1r2ya1: