Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein Hypothetical protein Ydr533Cp [102253] (1 species) contains a buried Cys-His-Glu triad within one subunit |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries) |
Domain d1qvvb_: 1qvv B: [96443] structural genomics |
PDB Entry: 1qvv (more details), 2.35 Å
SCOPe Domain Sequences for d1qvvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvvb_ c.23.16.2 (B:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mapkkvllaltsyndvfysdgaktgvfvvealhpfntfrkegfevdfvsetgkfgwdehs lakdflngqdetdfknkdsdfnktlakiktpkevnaddyqiffasaghgtlfdypkakdl qdiaseiyanggvvaavchgpaifdgltdkktgrpliegksitgftdvgetilgvdsilk aknlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalkn
Timeline for d1qvvb_: