Lineage for d1qs0b2 (1qs0 B:206-339)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the restSuperfamily c.48.1: TK C-terminal domain-like [52922] (4 families) 
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
automatically mapped to Pfam PF02780
Protein 2-oxoisovalerate dehydrogenase E1b, C-domain [52929] (1 species) Species Pseudomonas putida [TaxId:303] [52930] (1 PDB entry) 
Domain d1qs0b2: 1qs0 B:206-339 [33103]
Other proteins in same PDB: d1qs0a_, d1qs0b1
complexed with coi, mg, tdp
Details for d1qs0b2
PDB Entry: 1qs0 (more details), 2.4 Å
PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta-subunitSCOPe Domain Sequences for d1qs0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs0b2 c.48.1.2 (B:206-339) 2-oxoisovalerate dehydrogenase E1b, C-domain {Pseudomonas putida [TaxId: 303]}
yytvpldkaaitrpgndvsvltygttvyvaqvaaeesgvdaevidlrslwpldldtives
vkktgrcvvvheatrtcgfgaelvslvqehcfhhleapiervtgwdtpyphaqewayfpg
psrvgaalkkvmev
SCOPe Domain Coordinates for d1qs0b2:
Click to download the PDB-style file with coordinates for d1qs0b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qs0b2:
- d1qs0b2 first appeared (with stable ids) in SCOP 1.55
- d1qs0b2 appears in SCOPe 2.07
View in 3D
