![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
![]() | Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries) |
![]() | Domain d1qr2a_: 1qr2 A: [31231] complexed with fad, zn |
PDB Entry: 1qr2 (more details), 2.1 Å
SCOPe Domain Sequences for d1qr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qr2a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
Timeline for d1qr2a_: