PDB entry 1qr2

View 1qr2 on RCSB PDB site
Description: human quinone reductase type 2
Class: oxidoreductase
Keywords: quinone-reductase (cytosolic), oxidoreductase, flavoprotein, metalloenzyme
Deposited on 1999-04-15, released 1999-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (quinone reductase type 2)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16083 (0-229)
      • see remark 999 (138)
    Domains in SCOPe 2.07: d1qr2a_
  • Chain 'B':
    Compound: protein (quinone reductase type 2)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16083 (0-229)
      • see remark 999 (138)
    Domains in SCOPe 2.07: d1qr2b_
  • Heterogens: ZN, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qr2A (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qr2B (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq