Lineage for d1qovl_ (1qov L:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1698961Protein L (light) subunit [81477] (3 species)
  7. 1698962Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
    Uniprot P02954
  8. 1698964Domain d1qovl_: 1qov L: [43455]
    Other proteins in same PDB: d1qovh1, d1qovh2, d1qovm_
    complexed with bcl, bph, cdl, cl, fe2, spn, u10; mutant

Details for d1qovl_

PDB Entry: 1qov (more details), 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1qovl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qovl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1qovl_:

Click to download the PDB-style file with coordinates for d1qovl_.
(The format of our PDB-style files is described here.)

Timeline for d1qovl_: