Lineage for d1qoia_ (1qoi A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553286Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1553298Species Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId:9606] [50896] (2 PDB entries)
  8. 1553299Domain d1qoia_: 1qoi A: [27490]

Details for d1qoia_

PDB Entry: 1qoi (more details), 2 Å

PDB Description: u4/u6 snrnp-specific cyclophilin snucyp-20
PDB Compounds: (A:) snucyp-20

SCOPe Domain Sequences for d1qoia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]}
nsspvnpvvffdvsiggqevgrmkielfadvvpktaenfrqfctgefrkdgvpigykgst
fhrvikdfmiqggdfvngdgtgvasiyrgpfadenfklrhsapgllsmansgpstngcqf
fitcskcdwldgkhvvfgkiidgllvmrkienvptgpnnkpklpvvisqcgem

SCOPe Domain Coordinates for d1qoia_:

Click to download the PDB-style file with coordinates for d1qoia_.
(The format of our PDB-style files is described here.)

Timeline for d1qoia_: