| Class b: All beta proteins [48724] (176 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein Cyclophilin (eukaryotic) [50893] (13 species) |
| Species Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId:9606] [50896] (2 PDB entries) |
| Domain d1qoia_: 1qoi A: [27490] |
PDB Entry: 1qoi (more details), 2 Å
SCOPe Domain Sequences for d1qoia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]}
nsspvnpvvffdvsiggqevgrmkielfadvvpktaenfrqfctgefrkdgvpigykgst
fhrvikdfmiqggdfvngdgtgvasiyrgpfadenfklrhsapgllsmansgpstngcqf
fitcskcdwldgkhvvfgkiidgllvmrkienvptgpnnkpklpvvisqcgem
Timeline for d1qoia_: