Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins) Pfam PF02295 |
Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries) |
Domain d1qgpa_: 1qgp A: [16158] |
PDB Entry: 1qgp (more details)
SCOPe Domain Sequences for d1qgpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgpa_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} lsshfqelsiyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgkl qkeagtpplwkiavsd
Timeline for d1qgpa_: