Lineage for d1q5hb_ (1q5h B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964543Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 964544Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 964595Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 964629Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)
  8. 964637Domain d1q5hb_: 1q5h B: [95894]
    protein/DNA complex; complexed with dud, mg

Details for d1q5hb_

PDB Entry: 1q5h (more details), 2 Å

PDB Description: Human dUTP Pyrophosphatase complex with dUDP
PDB Compounds: (B:) dUTP pyrophosphatase

SCOPe Domain Sequences for d1q5hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5hb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfg

SCOPe Domain Coordinates for d1q5hb_:

Click to download the PDB-style file with coordinates for d1q5hb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5hb_: