Lineage for d1q2ra_ (1q2r A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 819122Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 819123Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 819134Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 819135Species Zymomonas mobilis [TaxId:542] [51716] (33 PDB entries)
    Uniprot P28720
  8. 819168Domain d1q2ra_: 1q2r A: [95634]

Details for d1q2ra_

PDB Entry: 1q2r (more details), 2.9 Å

PDB Description: chemical trapping and crystal structure of a catalytic trna guanine transglycosylase covalent intermediate
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOP Domain Sequences for d1q2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ra_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfarns

SCOP Domain Coordinates for d1q2ra_:

Click to download the PDB-style file with coordinates for d1q2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ra_: