Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC |
Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (1 protein) |
Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species) |
Species Escherichia coli [TaxId:562] [103504] (3 PDB entries) |
Domain d1q16c_: 1q16 C: [95549] Other proteins in same PDB: d1q16a1, d1q16a2, d1q16b_ complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4 |
PDB Entry: 1q16 (more details), 1.9 Å
SCOP Domain Sequences for d1q16c_:
Sequence, based on SEQRES records: (download)
>d1q16c_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
>d1q16c_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]} mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil gifvghffgmltphwmeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvrat ttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgva fifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh
Timeline for d1q16c_: