Lineage for d1q16c_ (1q16 C:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426093Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 426166Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) (S)
    possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
  5. 426167Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (1 protein)
  6. 426168Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)
  7. 426169Species Escherichia coli [TaxId:562] [103504] (1 PDB entry)
  8. 426170Domain d1q16c_: 1q16 C: [95549]
    Other proteins in same PDB: d1q16a1, d1q16a2, d1q16b_
    complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4

Details for d1q16c_

PDB Entry: 1q16 (more details), 1.9 Å

PDB Description: Crystal structure of Nitrate Reductase A, NarGHI, from Escherichia coli

SCOP Domain Sequences for d1q16c_:

Sequence, based on SEQRES records: (download)

>d1q16c_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records): (download)

>d1q16c_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvrat
ttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgva
fifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

SCOP Domain Coordinates for d1q16c_:

Click to download the PDB-style file with coordinates for d1q16c_.
(The format of our PDB-style files is described here.)

Timeline for d1q16c_: