Lineage for d1q0ub_ (1q0u B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
duplication: tandem repeat of two RecA-like (AAA) domains
Protein Probable DEAD box RNA helicase YqfR [102383] (1 species) Species Bacillus stearothermophilus [TaxId:1422] [102384] (1 PDB entry) 
Domain d1q0ub_: 1q0u B: [95513]
N-terminal domain only
Details for d1q0ub_
PDB Entry: 1q0u (more details), 1.85 Å
PDB Description: Crystal Structure of the BstDEAD N-terminal Domain
PDB Compounds: (B:) BstDEADSCOPe Domain Sequences for d1q0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0ub_ c.37.1.19 (B:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}
aetqftrfpfqpfiieaiktlrfykpteiqeriipgalrgesmvgqsqtgtgkthayllp
imekikperaevqavitaptrelatqiyhetlkitkfcpkdrmivarcliggtdkqkale
klnvqphivigtpgrindfireqaldvhtahilvvdeadlmldmgfitdvdqiaarmpkd
lqmlvfsatipeklkpflkkymenptfvhv
SCOPe Domain Coordinates for d1q0ub_:
Click to download the PDB-style file with coordinates for d1q0ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q0ub_:
- d1q0ub_ first appeared in SCOP 1.67
- d1q0ub_ appears in SCOPe 2.05
- d1q0ub_ appears in SCOPe 2.07
- d1q0ub_ appears in the current release, SCOPe 2.08
View in 3D
