Lineage for d1pytb_ (1pyt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889495Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2889496Protein Carboxypeptidase A [53189] (4 species)
  7. 2889499Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2889543Domain d1pytb_: 1pyt B: [33820]
    Other proteins in same PDB: d1pyta_, d1pytc_, d1pytd_
    complexed with ca, zn

Details for d1pytb_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
PDB Compounds: (B:) procarboxypeptidase a

SCOPe Domain Sequences for d1pytb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pytb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtlnnly

SCOPe Domain Coordinates for d1pytb_:

Click to download the PDB-style file with coordinates for d1pytb_.
(The format of our PDB-style files is described here.)

Timeline for d1pytb_: