Lineage for d1puga_ (1pug A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613451Fold d.222: YbaB-like [82606] (1 superfamily)
    core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123
  4. 2613452Superfamily d.222.1: YbaB-like [82607] (2 families) (S)
    forms tight dimer of a 3-layer structure: beta/alpha/beta
  5. 2613453Family d.222.1.1: YbaB-like [82608] (2 proteins)
    Pfam PF02575; DUF149; function unknown
  6. 2613457Protein Hypothetical upf0133 protein YbaB [89857] (1 species)
  7. 2613458Species Escherichia coli [TaxId:562] [89858] (1 PDB entry)
  8. 2613459Domain d1puga_: 1pug A: [88288]
    structural genomics

Details for d1puga_

PDB Entry: 1pug (more details), 2.2 Å

PDB Description: structure of e. coli ybab
PDB Compounds: (A:) Hypothetical UPF0133 protein ybaB

SCOPe Domain Sequences for d1puga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puga_ d.222.1.1 (A:) Hypothetical upf0133 protein YbaB {Escherichia coli [TaxId: 562]}
mkqaqqmqekmqkmqeeiaqlevtgesgaglvkvtingahncrrveidpslleddkemle
dlvaaafndaarrieetqkekmasvssgmqlppg

SCOPe Domain Coordinates for d1puga_:

Click to download the PDB-style file with coordinates for d1puga_.
(The format of our PDB-style files is described here.)

Timeline for d1puga_: