![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.222: YbaB-like [82606] (1 superfamily) core: alpha-beta(3)-alpha, 2 layers:alpha/beta, three-stranded antiparallel beta sheet, strand order 123 |
![]() | Superfamily d.222.1: YbaB-like [82607] (2 families) ![]() forms tight dimer of a 3-layer structure: beta/alpha/beta |
![]() | Family d.222.1.1: YbaB-like [82608] (2 proteins) Pfam PF02575; DUF149; function unknown |
![]() | Protein Hypothetical upf0133 protein YbaB [89857] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89858] (1 PDB entry) |
![]() | Domain d1puga_: 1pug A: [88288] structural genomics |
PDB Entry: 1pug (more details), 2.2 Å
SCOPe Domain Sequences for d1puga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puga_ d.222.1.1 (A:) Hypothetical upf0133 protein YbaB {Escherichia coli [TaxId: 562]} mkqaqqmqekmqkmqeeiaqlevtgesgaglvkvtingahncrrveidpslleddkemle dlvaaafndaarrieetqkekmasvssgmqlppg
Timeline for d1puga_: