Lineage for d1p69a_ (1p69 A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
sandwich, 10 strands in 2 sheets; greek-keySuperfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) 
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
automatically mapped to Pfam PF00541Protein Adenovirus fiber protein "knob" domain [49837] (8 species) 
Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries) 
Domain d1p69a_: 1p69 A: [94159]
Other proteins in same PDB: d1p69b_
mutant
Details for d1p69a_
PDB Entry: 1p69 (more details), 3.1 Å
PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant)
PDB Compounds: (A:) fiber proteinSCOPe Domain Sequences for d1p69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p69a_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpspncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe
SCOPe Domain Coordinates for d1p69a_:
Click to download the PDB-style file with coordinates for d1p69a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p69a_:
- d1p69a_ first appeared in SCOP 1.67
- d1p69a_ appears in SCOPe 2.02
- d1p69a_ appears in SCOPe 2.04
- d1p69a_ appears in the current release, SCOPe 2.08
View in 3D
