Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein Disabled homolog 2 (Dab2) [101830] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries) |
Domain d1p3rc_: 1p3r C: [94067] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1p3r (more details), 2.1 Å
SCOPe Domain Sequences for d1p3rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3rc_ b.55.1.2 (C:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg qqaeplvvdlkdlfqviynvkkkeed
Timeline for d1p3rc_: