Lineage for d1orsb1 (1ors B:1-118)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930274Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 930283Domain d1orsb1: 1ors B:1-118 [87351]
    Other proteins in same PDB: d1orsa1, d1orsa2, d1orsb2, d1orsc_
    part of anti-VD potassium channel KVAP Fab 33H1

Details for d1orsb1

PDB Entry: 1ors (more details), 1.9 Å

PDB Description: x-ray structure of the kvap potassium channel voltage sensor in complex with an fab
PDB Compounds: (B:) 33H1 Fab heavy chain

SCOPe Domain Sequences for d1orsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orsb1 b.1.1.1 (B:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtvss

SCOPe Domain Coordinates for d1orsb1:

Click to download the PDB-style file with coordinates for d1orsb1.
(The format of our PDB-style files is described here.)

Timeline for d1orsb1: