Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries) different sequence variants Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity |
Domain d1oqlb1: 1oql B:1-137 [87307] Other proteins in same PDB: d1oqla_ complexed with gal, nag |
PDB Entry: 1oql (more details), 3 Å
SCOPe Domain Sequences for d1oqlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqlb1 b.42.2.1 (B:1-137) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} ddvtcsaseptvrivgrngmcvdvrdddfrdgnqiqlwpsksnndpnqlwtikrdgtirs ngsclttygytagvyvmifdcntavreatlwqiwgngtiinprsnlvlaassgikgttlt vqtldytlgqgwlagnd
Timeline for d1oqlb1: