Lineage for d1okkd2 (1okk D:97-303)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1164938Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1165056Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 1165063Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)
  8. 1165064Domain d1okkd2: 1okk D:97-303 [93262]
    Other proteins in same PDB: d1okka1, d1okka2, d1okkd1
    complexed with bzp, edo, gcp, mg, so4

Details for d1okkd2

PDB Entry: 1okk (more details), 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases
PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d1okkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

SCOPe Domain Coordinates for d1okkd2:

Click to download the PDB-style file with coordinates for d1okkd2.
(The format of our PDB-style files is described here.)

Timeline for d1okkd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okkd1