![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.1: PhoB-like [46895] (3 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
![]() | Protein OmpR [46896] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46897] (2 PDB entries) |
![]() | Domain d1odd__: 1odd - [16232] |
PDB Entry: 1odd (more details), 2.2 Å
SCOP Domain Sequences for d1odd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odd__ a.4.6.1 (-) OmpR {Escherichia coli} aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd
Timeline for d1odd__: