Lineage for d1odd__ (1odd -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533965Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 533966Family a.4.6.1: PhoB-like [46895] (3 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 533967Protein OmpR [46896] (1 species)
  7. 533968Species Escherichia coli [TaxId:562] [46897] (2 PDB entries)
  8. 533970Domain d1odd__: 1odd - [16232]

Details for d1odd__

PDB Entry: 1odd (more details), 2.2 Å

PDB Description: ompr c-terminal domain (ompr-c) from escherichia coli

SCOP Domain Sequences for d1odd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odd__ a.4.6.1 (-) OmpR {Escherichia coli}
aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys
amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd

SCOP Domain Coordinates for d1odd__:

Click to download the PDB-style file with coordinates for d1odd__.
(The format of our PDB-style files is described here.)

Timeline for d1odd__: