Lineage for d1occc_ (1occ C:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060331Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1060332Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 1060333Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1060346Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1060347Species Cow (Bos taurus) [TaxId:9913] [81444] (23 PDB entries)
  8. 1060388Domain d1occc_: 1occ C: [43560]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occc_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (C:) cytochrome c oxidase

SCOPe Domain Sequences for d1occc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
ywhfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d1occc_:

Click to download the PDB-style file with coordinates for d1occc_.
(The format of our PDB-style files is described here.)

Timeline for d1occc_: