Lineage for d1o26c_ (1o26 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238756Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 2238757Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 2238758Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 2238759Protein Thy1 homologue [69798] (1 species)
  7. 2238760Species Thermotoga maritima [TaxId:2336] [69799] (25 PDB entries)
    TM0449
  8. 2238765Domain d1o26c_: 1o26 C: [86568]
    Other proteins in same PDB: d1o26a2, d1o26b2
    structural genomics
    complexed with fad, pge, ump

Details for d1o26c_

PDB Entry: 1o26 (more details), 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
PDB Compounds: (C:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o26c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o26c_ d.207.1.1 (C:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkev

SCOPe Domain Coordinates for d1o26c_:

Click to download the PDB-style file with coordinates for d1o26c_.
(The format of our PDB-style files is described here.)

Timeline for d1o26c_: