Lineage for d1o14a_ (1o14 A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.72: Ribokinase-like [53612] (3 superfamilies)
core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
potential superfamily: members of this fold have similar functions but different ATP-binding sitesSuperfamily c.72.1: Ribokinase-like [53613] (5 families) 
has extra strand located between strands 2 and 3Family c.72.1.1: Ribokinase-like [53614] (6 proteins) 
Protein Putative sugar kinase TM0828 [82518] (1 species) Species Thermotoga maritima [TaxId:243274] [82519] (1 PDB entry) 
Domain d1o14a_: 1o14 A: [80763]
Details for d1o14a_
PDB Entry: 1o14 (more details), 3.2 Å
PDB Description: Crystal structure of possible 1-phosphofructokinase (TM0828) from Thermotoga maritima at 3.2 A resolution
SCOP Domain Sequences for d1o14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o14a_ c.72.1.1 (A:) Putative sugar kinase TM0828 {Thermotoga maritima}
mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg
fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd
vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy
egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre
gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym
pdleaikkeydhftvervk
SCOP Domain Coordinates for d1o14a_:
Click to download the PDB-style file with coordinates for d1o14a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o14a_:
- d1o14a_ first appeared in SCOP 1.63
- d1o14a_ appears in SCOP 1.69
- d1o14a_ does not appear in SCOP 1.73
View in 3D
