Lineage for d1o14a_ (1o14 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492652Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 492653Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 492654Family c.72.1.1: Ribokinase-like [53614] (5 proteins)
  6. 492688Protein Putative sugar kinase TM0828 [82518] (1 species)
  7. 492689Species Thermotoga maritima [TaxId:243274] [82519] (1 PDB entry)
  8. 492690Domain d1o14a_: 1o14 A: [80763]

Details for d1o14a_

PDB Entry: 1o14 (more details), 3.2 Å

PDB Description: Crystal structure of possible 1-phosphofructokinase (TM0828) from Thermotoga maritima at 3.2 A resolution

SCOP Domain Sequences for d1o14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o14a_ c.72.1.1 (A:) Putative sugar kinase TM0828 {Thermotoga maritima}
mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg
fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd
vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy
egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre
gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym
pdleaikkeydhftvervk

SCOP Domain Coordinates for d1o14a_:

Click to download the PDB-style file with coordinates for d1o14a_.
(The format of our PDB-style files is described here.)

Timeline for d1o14a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o14b_