Lineage for d1o0rb_ (1o0r B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins) 
Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species) Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
Uniprot P08037 131-402
Domain d1o0rb_: 1o0r B: [86539]
complexed with dio, gdu, mes, mn, so4
Details for d1o0rb_
PDB Entry: 1o0r (more details), 2.3 Å
PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase complex with udp-galactose
PDB Compounds: (B:) beta-1,4-galactosyltransferaseSCOPe Domain Sequences for d1o0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0rb_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
sltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfr
nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
nywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtket
mlsdglnsltymvlevqryplytkitvdigtps
SCOPe Domain Coordinates for d1o0rb_:
Click to download the PDB-style file with coordinates for d1o0rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o0rb_:
- d1o0rb_ first appeared in SCOP 1.65
- d1o0rb_ appears in SCOPe 2.06
- d1o0rb_ appears in the current release, SCOPe 2.08
View in 3D
