Lineage for d1nngb_ (1nng B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.1: 4HBT-like [54638] (19 proteins)
Pfam PF03061
Protein automated matches [190155] (3 species)
not a true proteinSpecies Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries) 
Domain d1nngb_: 1nng B: [302772]
automated match to d1ylib_
complexed with ca, coa, gol
Details for d1nngb_
PDB Entry: 1nng (more details), 1.95 Å
PDB Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.
PDB Compounds: (B:) Putative acyl-CoA thioester hydrolase HI0827SCOPe Domain Sequences for d1nngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nngb_ d.38.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
vdnngrsrtiprennqelekalaliseq
SCOPe Domain Coordinates for d1nngb_:
Click to download the PDB-style file with coordinates for d1nngb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nngb_:
- d1nngb_ first appeared in SCOPe 2.06
- d1nngb_ appears in SCOPe 2.07
View in 3D
