PDB entry 1nng

View 1nng on RCSB PDB site
Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.
Class: hydrolase
Keywords: Structural Genomics, HI0827, YCIA_HAEIN, thioesterase, coenzyme A
Deposited on 2003-01-13, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-02-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative acyl-CoA thioester hydrolase HI0827
    Species: Haemophilus influenzae
    Gene: HI0827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nnga_
  • Chain 'B':
    Compound: Putative acyl-CoA thioester hydrolase HI0827
    Species: Haemophilus influenzae
    Gene: HI0827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nngb_
  • Heterogens: CA, COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nngA (A:)
    sanftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvt
    vavesmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavft
    fvavdnngrsrtiprennqelekalaliseqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nngA (A:)
    rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi
    kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr
    srtiprennqelekalalise
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nngB (B:)
    sanftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvt
    vavesmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavft
    fvavdnngrsrtiprennqelekalaliseqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nngB (B:)
    ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
    esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
    vdnngrsrtiprennqelekalaliseq