Lineage for d1nmra_ (1nmr A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778923Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 778924Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 778925Family a.144.1.1: PABC (PABP) domain [63571] (2 proteins)
  6. 778929Protein poly(A) binding protein [63572] (3 species)
  7. 778936Species Protozoan (Trypanosoma cruzi) [TaxId:5693] [101231] (1 PDB entry)
  8. 778937Domain d1nmra_: 1nmr A: [91992]

Details for d1nmra_

PDB Entry: 1nmr (more details)

PDB Description: solution structure of c-terminal domain from trypanosoma cruzi poly(a)-binding protein
PDB Compounds: (A:) poly(A)-binding protein

SCOP Domain Sequences for d1nmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmra_ a.144.1.1 (A:) poly(A) binding protein {Protozoan (Trypanosoma cruzi) [TaxId: 5693]}
gsslasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeiln
lldtpglldakvqealevlnrhmnv

SCOP Domain Coordinates for d1nmra_:

Click to download the PDB-style file with coordinates for d1nmra_.
(The format of our PDB-style files is described here.)

Timeline for d1nmra_: