Lineage for d1nmra_ (1nmr A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926441Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 926442Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 926443Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 926447Protein poly(A) binding protein [63572] (3 species)
  7. 926454Species Trypanosoma cruzi [TaxId:5693] [101231] (1 PDB entry)
  8. 926455Domain d1nmra_: 1nmr A: [91992]

Details for d1nmra_

PDB Entry: 1nmr (more details)

PDB Description: solution structure of c-terminal domain from trypanosoma cruzi poly(a)-binding protein
PDB Compounds: (A:) poly(A)-binding protein

SCOPe Domain Sequences for d1nmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmra_ a.144.1.1 (A:) poly(A) binding protein {Trypanosoma cruzi [TaxId: 5693]}
gsslasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeiln
lldtpglldakvqealevlnrhmnv

SCOPe Domain Coordinates for d1nmra_:

Click to download the PDB-style file with coordinates for d1nmra_.
(The format of our PDB-style files is described here.)

Timeline for d1nmra_: