Lineage for d1nkla_ (1nkl A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771691Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 771692Superfamily a.64.1: Saposin [47862] (4 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 771693Family a.64.1.1: NKL-like [47863] (3 proteins)
  6. 771697Protein NK-lysin, NKL [47864] (1 species)
  7. 771698Species Pig (Sus scrofa) [TaxId:9823] [47865] (1 PDB entry)
  8. 771699Domain d1nkla_: 1nkl A: [18140]
    CASP2

Details for d1nkla_

PDB Entry: 1nkl (more details)

PDB Description: nk-lysin from pig, nmr, 20 structures
PDB Compounds: (A:) nk-lysin

SCOP Domain Sequences for d1nkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]}
gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdi
ltgkkpqaicvdikicke

SCOP Domain Coordinates for d1nkla_:

Click to download the PDB-style file with coordinates for d1nkla_.
(The format of our PDB-style files is described here.)

Timeline for d1nkla_: