Lineage for d1njsa_ (1njs A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.65: Formyltransferase [53327] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the restSuperfamily c.65.1: Formyltransferase [53328] (2 families) 
Family c.65.1.1: Formyltransferase [53329] (4 proteins) 
Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries) 
Domain d1njsa_: 1njs A: [85823]
complexed with keu, po4
Details for d1njsa_
PDB Entry: 1njs (more details), 1.98 Å
PDB Description: human GAR Tfase in complex with hydrolyzed form of 10-trifluoroacetyl-5,10-dideaza-acyclic-5,6,7,8-tetrahydrofolic acid
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferaseSCOPe Domain Sequences for d1njsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njsa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv
SCOPe Domain Coordinates for d1njsa_:
Click to download the PDB-style file with coordinates for d1njsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1njsa_:
- d1njsa_ first appeared in SCOP 1.65
- d1njsa_ appears in SCOP 1.75
- d1njsa_ appears in SCOPe 2.02
- d1njsa_ appears in the current release, SCOPe 2.08
View in 3D
