| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) ![]() |
| Family g.37.1.3: Plant C2H2 finger (QALGGH zinc finger) [90198] (1 protein) |
| Protein SUPERMAN zinc finger domain [90199] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [90200] (1 PDB entry) |
| Domain d1njqa_: 1njq A: [85822] complexed with ace, nh2, zn |
PDB Entry: 1njq (more details)
SCOP Domain Sequences for d1njqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wpprsytcsfckrefrsaqalgghmnvhrrdrarlrl
Timeline for d1njqa_: