Lineage for d1njqa_ (1njq A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892334Family g.37.1.3: Plant C2H2 finger (QALGGH zinc finger) [90198] (1 protein)
  6. 892335Protein SUPERMAN zinc finger domain [90199] (1 species)
  7. 892336Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [90200] (1 PDB entry)
  8. 892337Domain d1njqa_: 1njq A: [85822]
    complexed with ace, nh2, zn

Details for d1njqa_

PDB Entry: 1njq (more details)

PDB Description: nmr structure of the single qalggh zinc finger domain from arabidopsis thaliana superman protein
PDB Compounds: (A:) superman protein

SCOP Domain Sequences for d1njqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wpprsytcsfckrefrsaqalgghmnvhrrdrarlrl

SCOP Domain Coordinates for d1njqa_:

Click to download the PDB-style file with coordinates for d1njqa_.
(The format of our PDB-style files is described here.)

Timeline for d1njqa_: