Lineage for d1njqa_ (1njq A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343849Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 343850Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (3 families) (S)
  5. 343988Family g.37.1.3: Plant C2H2 finger (QALGGH zinc finger) [90198] (1 protein)
  6. 343989Protein SUPERMAN zinc finger domain [90199] (1 species)
  7. 343990Species Arabidopsis thaliana [TaxId:3702] [90200] (1 PDB entry)
  8. 343991Domain d1njqa_: 1njq A: [85822]
    complexed with ace, nh2, zn

Details for d1njqa_

PDB Entry: 1njq (more details)

PDB Description: nmr structure of the single qalggh zinc finger domain from arabidopsis thaliana superman protein

SCOP Domain Sequences for d1njqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Arabidopsis thaliana}
wpprsytcsfckrefrsaqalgghmnvhrrdrarlrl

SCOP Domain Coordinates for d1njqa_:

Click to download the PDB-style file with coordinates for d1njqa_.
(The format of our PDB-style files is described here.)

Timeline for d1njqa_: