| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
| Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries) |
| Domain d1ni4b1: 1ni4 B:0-191 [85729] Other proteins in same PDB: d1ni4a_, d1ni4b2, d1ni4c_, d1ni4d2 complexed with k, mg, tpp |
PDB Entry: 1ni4 (more details), 1.95 Å
SCOPe Domain Sequences for d1ni4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni4b1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
slqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpise
mgfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpng
asagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvp
fefppeaqskdf
Timeline for d1ni4b1:
View in 3DDomains from other chains: (mouse over for more information) d1ni4a_, d1ni4c_, d1ni4d1, d1ni4d2 |